DPCstruct | MC34749
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 96 ± 5 aa |
| Standard deviation of domain lengths | 4.55 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 72.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8J954 | 95-186 | LSSNMYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLE… |
| A0A3Q0E6P7 | 94-187 | MLTLPTFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQTYATAEPFIDAKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAML… |
| A0A672Q7F2 | 67-160 | None |
| A0A7N6AB74 | 125-221 | None |
| A0A1A8GXB9 | 95-190 | None |
| A0A812DP95 | 30-123 | None |
| A0A2B4T097 | 8-100 | None |
| A0A401PRD6 | 1-110 | None |
| A0A1S3SF46 | 261-355 | None |
| A0A3Q1MAE2 | 36-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.