DPCstruct | MC34748
Metacluster Properties and Pfam Annotations
| Number of structural domains | 123 |
|---|---|
| Mean domain length (aa) | 72 ± 13 aa |
| Standard deviation of domain lengths | 12.53 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 59.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W3GN66 | 8-69 | TGHGGLNQLGGMFVNGRPLPDVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRSVQAH |
| A0A812E2C9 | 13-74 | RNINQYGREFTNGRPLPDHLRVQILQLALQGVRPCEISRQLQVSHGCVSKILNRYRKTGSIN |
| A0A3P6QVT3 | 23-103 | None |
| A0A0K0DUC0 | 138-209 | None |
| A0A0K0EKE3 | 215-297 | None |
| A0A1I8IK63 | 2-65 | None |
| A0A7R9L3G1 | 83-158 | None |
| A0A212CA84 | 56-117 | None |
| G0PIG5 | 93-185 | None |
| A0A0D8XCB5 | 30-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.