DPCstruct | MC3474
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 347 ± 36 aa |
| Standard deviation of domain lengths | 36.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 23.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9ZAB1 | 7-298 | APSGCEIWKDEKLKYHGPLHALKEEVKEYNKRINNFHPSTMEDLRDRLRRGEPKNGVCDGTKIHPNGLNGIFTSGQISLSRSGYIEP… |
| A0A699ZYQ7 | 5-367 | SSRPCNASVSGGNIAPSYRKHRRMYSCWRCCCGATSVLLVLLSGRSAVAMLHCRQSAVRYVPSTYELQMRQENTTSWDLDYCRAYTA… |
| B8LCR2 | 60-452 | None |
| A0A5A8DAZ7 | 121-526 | None |
| A0A821J202 | 42-425 | None |
| A0A1Q9CGV4 | 18-372 | None |
| A0A1Q9C7L8 | 30-388 | None |
| A0A812VNL2 | 197-515 | None |
| A0A813GZP1 | 444-764 | None |
| A0A813M4W7 | 213-531 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.