DPCstruct | MC34738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 98 ± 4 aa |
| Standard deviation of domain lengths | 4.01 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 82.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 49.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10165 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2KL26 | 428-526 | LKVIPPLKDKDVEHRPEEGKTLRNKVVRVMMSPSHSKEVAAEFLFILCKRSVSRLIKYSGFGHSAGLLANSGLLGQVHLPKRSSDSE… |
| A0A6A5GWK9 | 20-118 | SHVLPPLVADEVKKRPEEHNSLRGRIVRIMMLPSATKDVAAEFLFIICKRSVNRMIKYVGFGHSAGHLANLGLLGQINQPKHASDSE… |
| A0A1W0X5J9 | 351-450 | None |
| A0A820PZT8 | 1-100 | None |
| A0A1I8F4V5 | 121-206 | None |
| A0A383Z895 | 243-340 | None |
| A0A2I0LIL1 | 134-229 | None |
| A0A553PBP5 | 198-297 | None |
| A0A3P7R0D7 | 63-161 | None |
| A0A7J7X1M3 | 165-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.