DPCstruct | MC34734
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 249 ± 24 aa |
| Standard deviation of domain lengths | 24.35 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A9PPH4 | 9-275 | IECRFMNYGWEPTLHPSSFAPFRSEPYTAEGWFSLDRGTWLLSALPPLLNQSLTMAYGGSWQELADELNSDLASIKNKRTIYEILMW… |
| A0A2C5Z6M7 | 101-363 | HDCAPMRLSGSAYNFDCSELHLRYSMWCQPVNVATVVRDALPEEMLKMMLEVHGIDSNEVWRRIFKDLQKTDAQKTRLHQLRWIGDA… |
| A0A2C5X8H0 | 7-234 | None |
| A0A2C5YGN1 | 6-244 | None |
| A0A2C5Y5G1 | 3-276 | None |
| A0A2C5Y0U7 | 782-1044 | None |
| A0A2C5XUU7 | 22-258 | None |
| A0A2C5XUI0 | 3-270 | None |
| A0A2C5XM07 | 32-299 | None |
| A0A2C5XIY9 | 133-388 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.