DPCstruct | MC34732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 323 ± 34 aa |
| Standard deviation of domain lengths | 33.53 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A166WL38 | 1-332 | MKLAALGAALFAAQVWCQSSSFLRADESEERKRDLLSKLRQGLTLGLSNADYKSDLKEPTCEPHWNPWNLLETVFVSEKLFTDIGSV… |
| A0A2A9PMR0 | 1-324 | MNIKLLVSASCALLVLAHEYWRDDLKLNDLKKRLEQDSRVDRERAPYYNSTQMEPKPCKWSESYSWPLSGRKLCDNVYYWVEEEFLL… |
| T5A834 | 2-310 | None |
| A0A2C5Y6X0 | 3-346 | None |
| A0A0F7ZUZ2 | 31-320 | None |
| T5AM59 | 1-320 | None |
| T5ACP3 | 24-335 | None |
| A0A2C6ANI2 | 92-508 | None |
| A0A369H9R7 | 1-310 | None |
| A0A2C6ACE1 | 34-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.