DPCstruct | MC34730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 146 ± 19 aa |
| Standard deviation of domain lengths | 19.49 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.24 |
| Pfam Score | 98.21 |
| Assigned Pfam label(s) | PF01124- PF05821 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A9PB55 | 20-162 | RLPTTQRRGFLPPQFSDWKVLEEKYPERKVLSEVEDPEMNGGYINPPRIKRQHRDPYADWWDPQERRNFGEPVHEDNDTLGIFSPYE… |
| A0A6P3IZG0 | 12-160 | ITKDMLPGPYPKTPEERAAAAKKYNMRVEDYEPYPDDGTGYGDYPKLPDRSQQERDPWYDWDHPDLRLNWGEPMHWDLDMYIRNRVD… |
| A0A0B7NEI4 | 11-123 | None |
| A0A1I8JN93 | 1-157 | None |
| A0A6A6RTI1 | 2-168 | None |
| A0A433QMV6 | 3-141 | None |
| A0A7R9GYK9 | 27-228 | None |
| A0A1B7P6T4 | 1-135 | None |
| A0A5J5CI00 | 150-316 | None |
| R9PNB2 | 7-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.