DPCstruct | MC3473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 114 ± 8 aa |
| Standard deviation of domain lengths | 8.10 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453BV76 | 1-98 | LPTYRVAPQLEVRLEEFELFAIDRLRVLKGISDGLSRGKRPEEMEKLVSELWKAHMRHQDPAETLNKDIISHFVLRLVYCRTEELRK… |
| A0A699ZUK8 | 27-138 | ASNALQSKAGQHSTRHTTLSMYSELPVGDISLEDFEQLALDRLRVLKGVEEVKLRNKSDAEVQARARELVDRHLKGNDNEDTARRDQ… |
| A0A836AU99 | 77-194 | None |
| A0A3Q0CYW1 | 1-127 | None |
| A0A7J7M0V6 | 4-115 | None |
| A0A2C5Z7Q8 | 36-140 | None |
| A0A1J1HHU2 | 27-138 | None |
| A0A225UB44 | 11-122 | None |
| A0A498HLL9 | 315-425 | None |
| A0A0V0VFZ0 | 9-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.