DPCstruct | MC34729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 112 ± 16 aa |
| Standard deviation of domain lengths | 16.05 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4SQ27 | 17-125 | QYIGSHNSYHAGFAPSEATLLQRLSPELFAALDYRHPPLRQQLDDGVRQLELDVFADANGGRYAHPASVAQIAQAGLPPAPPSAPAG… |
| M7T3Q2 | 212-315 | QVVGTHNSYHRESPIEAKEVQASILPNITNYYYSHAALDIQADYMSVRNFELDIFPDPDGGLYAHPLVTTLSGTDPPPQDVMNKAGI… |
| A0A013WFW8 | 1-92 | None |
| A0A6V8QJL6 | 801-912 | None |
| J8VG98 | 1-96 | None |
| A0A0D3LE65 | 399-507 | None |
| A0A2P5A076 | 10-112 | None |
| A0A1V8SK99 | 310-417 | None |
| A0A7C7Z7B8 | 24-124 | None |
| A0A520J8C4 | 18-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.