DPCstruct | MC34722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 123 ± 16 aa |
| Standard deviation of domain lengths | 16.35 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02514 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7HTR3 | 83-193 | LGVRPRWHEHSGRVEGLEVISLEDLGRPRVDVTVRISGFFRDAFPDVVDLIDDAVRLVGELDEQPDDNPIRAAGLDDARVFGPAPGA… |
| A0A212DTP7 | 2-93 | GCRPQWDAATGRVTGIEVLPPASLGRPRVDVTWRISGLFRDMFPTQIALIDAAANAVATRDEDASENPLAARTRTEGKISPRIFGTS… |
| A0A1E3H0K6 | 461-571 | None |
| A0A0B8PBR4 | 300-420 | None |
| A0A2N9IQT3 | 348-436 | None |
| A0A7G9ZA00 | 462-581 | None |
| A0A7J9T4V9 | 226-383 | None |
| A0A7W7A4Z3 | 590-694 | None |
| A0A396QIY4 | 78-210 | None |
| A0A843DZZ9 | 702-829 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.