DPCstruct | MC34719
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 101 ± 14 aa |
| Standard deviation of domain lengths | 14.41 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.54 |
| Pfam Score | 77.27 |
| Assigned Pfam label(s) | PF17770- CL0398 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8AKA7 | 199-286 | VEMFRLVQPQMLVPVHGEMRHLVAHADLARACGAAAMVVENGQMISLGPDRPAFLGTVPVGRVVVDGCRLVPIDSQILRSRKRMMFNG |
| A0A3D5YI00 | 2-114 | EDHKLFLSLLRPNFFLPFYMPAAERYAHKKIALDMGMPNEKILMPNLNGNIIEMYDDVVLVSNERLKLDKILVDGKGKGHLSGEYVI… |
| A0A0F6TDQ3 | 458-530 | None |
| A0A554JDL5 | 649-739 | None |
| A0A0D3BFF6 | 479-576 | None |
| A0A3B0PBK7 | 214-324 | None |
| A0A7Y5RQT6 | 65-154 | None |
| A0A834WYM6 | 100-209 | None |
| A0A834WYP8 | 427-540 | None |
| A0A834WZ45 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.