DPCstruct | MC34716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 70 ± 3 aa |
| Standard deviation of domain lengths | 3.32 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 55.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5ZKV3 | 1-60 | MFIDKGEIKEILQLHLTVKVPAGMQSEDLARPVIEVSSFFDKEVVFEIYTFGEQIVVIPL |
| A0A7C2QWH0 | 242-311 | GVIPSIIDTVIFINKGKIEKVLMLSISVKVPEGMLDPGLARPVVEVRNFEDGTLEYEIYTFGEQTIIVPV |
| A0A0B3AL22 | 2-73 | None |
| A0A843H5G2 | 395-463 | None |
| A0A117STQ7 | 377-447 | None |
| A0A7C5T4E8 | 157-229 | None |
| A0A832Z2U2 | 1-67 | None |
| A0A7L4RC40 | 98-166 | None |
| A0A7C7Q6X4 | 25-97 | None |
| A0A843HL77 | 69-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.