DPCstruct | MC34713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Standard deviation of domain lengths | 7.52 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 42.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3VAW9 | 1-75 | LYDDELIYRAERIINWCPRCLTAISDIEVEYQDDDGELVSMKYGDGDDTIVVATTRAETMLGDTAVAVHPDDERY |
| A0A359N0R0 | 1-69 | MVNYSPALKTVVSDIEVEYKEEQAEMYYITYFVSGSDNELVVATTRPETMLADQAIAVNPKDKRYKRLI |
| A0A2G3BCZ6 | 79-170 | None |
| X1HVQ8 | 71-146 | None |
| A0A4Q3SF65 | 161-245 | None |
| A0A2X2T4L5 | 161-242 | None |
| A0A376LI55 | 161-242 | None |
| A0A2V3IUU2 | 13-88 | None |
| A0A0J9W6L0 | 48-124 | None |
| A0A820JBV9 | 86-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.