DPCstruct | MC34712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 85 ± 5 aa |
| Standard deviation of domain lengths | 5.21 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17657 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A149UIY4 | 161-244 | LKRGLDFLKEQGVIVDLSRIPLDDAKTFEMLAKGDTAGVFQFEGAGMRDMLKQMAASRLEDLIAGVSLYRPGPMANIPDYCRRK |
| A0A359N0J0 | 1-82 | MNIIKNNHEIDINLLKIDYEDKKVFKIFAAGDTTGVFQFESSGMRKYLRDLKPNTFEDIIVMVSLYRPGPLAYIPTYIARKH |
| A0A7C2GGG8 | 8-88 | None |
| A0A2X1PLG9 | 478-564 | None |
| A0A0G1XS63 | 136-217 | None |
| A0A3D5YGF1 | 1-100 | None |
| A0A380E526 | 94-175 | None |
| Q3JUI9 | 1080-1167 | None |
| A7T7F1 | 151-232 | None |
| A0A1B0FF46 | 239-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.