DPCstruct | MC34711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 151 ± 22 aa |
| Standard deviation of domain lengths | 21.57 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351Y4C2 | 9-137 | SETYKNILTNNIYGVDLNEESVEITKLSLWLKSAQKGKKLNNLDGNIKCGNSLIDDVFIAREKAFDWNVQFKEIMKNGGFNVIVGNP… |
| A0A826N5G8 | 4-160 | FEVKREILCKCIYGIDKDYNATKACTFGLLLKLLEGETTETIGKDTPILPALDTNILFGNSLIDSGDKVKQEDIFSINPFDLTNYQF… |
| A0A3D3UVI3 | 1-188 | None |
| A0A2G9PJX9 | 415-569 | None |
| A0A0E3QLE6 | 258-439 | None |
| A0A495V8F0 | 507-665 | None |
| A0A842ZMJ1 | 2-113 | None |
| A0A3A4VGF8 | 40-197 | None |
| A0A7W1P2M5 | 5-133 | None |
| A0A7C5XZH6 | 83-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.