DPCstruct | MC34710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 61 ± 4 aa |
| Standard deviation of domain lengths | 3.58 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 95.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351Y4C6 | 1-54 | MITVDNGITSIQEAIYAKEQEVDLIITDHHQPLEILPAAFALVNPQVSPDYPFK |
| A0A136P488 | 71-133 | LAEQGVTLVITVDCGITAVEQVRYAASRSIDVIVCDHHEPGDELPPAYALLDPIKPGCSYPFK |
| A0A5D0MEC3 | 125-187 | None |
| W4VL67 | 2-55 | None |
| A0A6I1PAD9 | 36-97 | None |
| A0A3D5YEJ2 | 1-63 | None |
| A0A0G0RMU4 | 34-97 | None |
| A0A6I5NZW6 | 114-172 | None |
| A0A356GCH2 | 132-194 | None |
| A0A359MYG6 | 9-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.