DPCstruct | MC34700
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 165 ± 6 aa |
| Standard deviation of domain lengths | 5.55 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 73.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.86 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3KMF8 | 1-167 | MQHHYPTSPNTVHQHSFEYEQPAPSSSSLVDRRRSPTARRLSPQDLIPHDAPTQSRRYITPSATSRRDAPSSFQRRSSYSRVSDEEE… |
| A0A166UC62 | 94-251 | LEAPPPPPPVKAPPPPPHTRRKSSATGTRKNVTPETLVPIDAPTQTRKYVTPSVTSRKEVPAVFARKRARSQAFGDEQDELEEDMVT… |
| A0A146IP48 | 295-466 | None |
| V2XHN0 | 49-208 | None |
| A0A067TUN4 | 34-202 | None |
| A0A4Y7SMK1 | 145-304 | None |
| A0A1M8A863 | 197-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.