DPCstruct | MC3470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 113 ± 17 aa |
| Standard deviation of domain lengths | 17.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A699ZQ76 | 1-100 | MDHANVYTQYRPSKLTEGRDHPDPIVESQSLSGTSPPDPDYAHHLGREVAEGRISNAQLETVVYACMRFKRFLPSGERCGFFLGDGA… |
| A0A2A2M333 | 132-254 | EEAVGVYLPYRPSRIAIGCASQHPTALVESIAMGSITAPRPSYRPQLPAHVVDGKVLSDAQLETLIYASDAFERDLPGRFLPAEEGL… |
| A0A383WCQ9 | 321-446 | None |
| A0A2G3BCB2 | 142-264 | None |
| A0A183M7Y0 | 11-99 | None |
| A0A6A4KIK3 | 245-330 | None |
| A0A1Q9C4V7 | 211-308 | None |
| A0A7S2S217 | 134-232 | None |
| A0A251STD4 | 165-284 | None |
| A0A212DTC2 | 19-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.