DPCstruct | MC347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 141 ± 18 aa |
| Standard deviation of domain lengths | 17.88 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 24.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534XBH5 | 7-167 | VTISALVLLAAGVSPARAQCPCTHTTTKIKGSLTATPGRFNYNAQLGLPGANSACNTHFPGTHACTYAELQSAPTGDRCQLKDTAGN… |
| A0A522BSR7 | 135-250 | IGKFDKLTPTSYNGAVGNYKTVNDACVAASGAGAHICTPDEMLATVRCAPTLVPVSGNAWVANGPPGFTSPAANDCAGWTSGASTAY… |
| A0A7C5FNJ1 | 265-390 | None |
| A0A0S7ZJ50 | 74-227 | None |
| A0A534WEN2 | 88-238 | None |
| A0A349D1W4 | 291-418 | None |
| A0A534U3R8 | 295-443 | None |
| A0A2D6RG08 | 132-282 | None |
| A0A1F5TRW8 | 1046-1174 | None |
| A0A2D6HFE6 | 18-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.