DPCstruct | MC34698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 211 ± 39 aa |
| Standard deviation of domain lengths | 39.28 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 15.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0287 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3KF55 | 105-344 | VMQRSKFEGDLTDLFTVGPAPVAIAETTTVVNETPVAVTFSVLGELTIPSDGIDHQCRVKNNSDYRLLPGSVMVIYDEIVVSTTRIS… |
| A0A7V2UVB7 | 191-402 | VDVPIRKKFVFNWRSGQPVPDEPNQRYVTHHYVIKNVKPAAAPADPDATPLGSFPLPTGKVRIFQKDGRGGEAFTGEDWGRFTPIDD… |
| A0A1E3G4W2 | 205-365 | None |
| A0A7S3LQF4 | 305-497 | None |
| A0A814TXF2 | 49-226 | None |
| A0A0T5Z6D7 | 2-165 | None |
| A0A7W0YJ19 | 65-290 | None |
| A0A813U609 | 175-449 | None |
| A0A2Z6AHD0 | 817-1005 | None |
| A0A813RLQ2 | 4-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.