DPCstruct | MC34697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 86 ± 10 aa |
| Standard deviation of domain lengths | 9.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067S3D3 | 655-736 | LTAGTRDIALHALDRVPIYDARHTLFDAEKDWTDLANLLPPFLQEVPRGSFVAVAYTCNIYFASEKWNLSPNVQFVVVLGTP |
| A0A5C3KF31 | 12-87 | LNYDTEIPVYDACGVRKFDISAVSLSDIDSSLKRWKGKVPVDSVVVVGYTISVFMSRGGHWTLGCNIQWAIVLLAP |
| A0A4S8LY22 | 54-143 | None |
| A0A0C3EV07 | 1-83 | None |
| A0A165WJU6 | 78-163 | None |
| S7PV62 | 32-137 | None |
| A0A5C3KUV5 | 153-248 | None |
| A0A369JBE5 | 50-128 | None |
| K5W159 | 274-372 | None |
| A8N573 | 78-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.