DPCstruct | MC34696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 131 ± 7 aa |
| Standard deviation of domain lengths | 7.02 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 77.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3KAU8 | 1-124 | MAEETVLPIPNLALSQNLFVLSTPSLGHLHDKARADLLAGIRADEMGPWYKNIPASNTALGLADDGALRGELEARNTQELGKLDERL… |
| A0A2P2LE96 | 2-127 | EGYEGTQQPQLILAHKRFLLSHPDVQDIEKVRLKEEVLAAVKADDMVPFYETLVADGLLEKDQGLLDSMRTKNEEELKKLDEKIADA… |
| C1BSX2 | 1-132 | None |
| A0A085MH77 | 311-446 | None |
| A0A284RVM5 | 9-125 | None |
| A0A7J6QZJ2 | 241-366 | None |
| A0A813FDF1 | 1-133 | None |
| A0A5N5SVI6 | 1-140 | None |
| A0A444TNW6 | 1-125 | None |
| A0A7R9BTG4 | 1-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.