DPCstruct | MC34693
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 635 ± 71 aa |
| Standard deviation of domain lengths | 70.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9UCX2 | 222-779 | NDAVHGHAFQDKVKLTLSGTNAKKATISASIDQADSGLTASVDGSTVTISGTPAAFGTYTATITAVAPDESGNGTQSKSVTANITVH… |
| A0A3R6LZJ2 | 1-711 | MKSGNSIIISATGYSDLALKFIIDTNGKASLVADDGKGDPYELHVKIDGSFEAAIVGQKDYDGVSGASSGGTSSNKNSAVTVYGALV… |
| A0A6N6NN78 | 269-783 | None |
| A0A1K1PB10 | 9-631 | None |
| A0A851IA66 | 399-1050 | None |
| A0A1C6GMG6 | 28-673 | None |
| A0A1H8JT18 | 235-808 | None |
| R5D612 | 1-709 | None |
| V1CRX3 | 185-773 | None |
| X8GTM1 | 181-945 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.