DPCstruct | MC3469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 168 ± 25 aa |
| Standard deviation of domain lengths | 24.50 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 68.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09649 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0VX95 | 129-248 | KKHRKDKEQKPQKKATAQPPSEEVLRLKELAKKCGLLIAPNVYRGNPTNEELEERLGAFLLSSGLKSLHPKQGDISKLKAERTLAAE… |
| A0A699ZHY9 | 2-129 | TNSPSPCGVRHQTAPAKKYSGKVEKLRNICRLASVKIPPGVYKAKSDAGVEEALQALLSKHGLNASSSEAKISQVKKKLEKERELDG… |
| A0A1X2IHA1 | 123-313 | None |
| A0A815WFB8 | 1-208 | None |
| A0A7N8YCS4 | 182-370 | None |
| A0A2B4SJB7 | 265-470 | None |
| A0A061R8X5 | 75-233 | None |
| A0A6D2JEY8 | 27-230 | None |
| A0A7S3ZYF7 | 61-193 | None |
| A0A146HR55 | 508-677 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.