DPCstruct | MC34687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 80 ± 5 aa |
| Standard deviation of domain lengths | 5.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q1NRL8 | 8-84 | QQQLVPLFHSHPCWMIEPLAGELGCSVPSTRRYLKAVGYYSSFTHNGKWYTLKSIPRFDRDGLWFHELIGFSRAGSL |
| A0A7Y3UJ68 | 2-86 | IKSGSLTLDNLRELFYKITTPTIEELKNALGTNSRMTVFRKLSELSYISSYSHRGKYYALVEQAKFDKTGLWSCGEAMFSCHGNF |
| A0A7X1GMB2 | 39-115 | None |
| A0A661S6Z9 | 1-79 | None |
| A0A7C3UTJ4 | 2-71 | None |
| A0A7V5F0E6 | 1-85 | None |
| A0A1E3X2F4 | 1-86 | None |
| A0A318D0B4 | 1-85 | None |
| A0A7C8D795 | 12-88 | None |
| A0A836RPL6 | 3-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.