DPCstruct | MC34683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 161 ± 37 aa |
| Standard deviation of domain lengths | 36.56 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 84.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 11.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0731 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V6Q5Q2 | 1-121 | MPVVIAKKDQSFLFSTVKPLPAFPIRIRDIKINVRQVNFNVIENFVIFDLEISQDVVYVVDGRVTVQGFSDVFSGAMPVPGAQKGME… |
| A0A833HMJ4 | 22-182 | PDLKAECIIGHKVFAHYQQNRLEETIIELPDEGTFEFSNIKFSNGNIKPASLIISNLSNRPNFKRVQLSITISYKLEVKQKENGEAI… |
| K4LJ48 | 21-182 | None |
| A0A371RWV6 | 1-116 | None |
| A0A7V6X024 | 340-458 | None |
| T2RCP0 | 71-227 | None |
| A0A7C6SVV1 | 7-152 | None |
| R5D2R5 | 2-231 | None |
| A0A3S9H2X4 | 9-192 | None |
| A0A4U1MMI6 | 17-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.