DPCstruct | MC34682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 151 |
|---|---|
| Mean domain length (aa) | 147 ± 29 aa |
| Standard deviation of domain lengths | 28.95 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.90 |
| Pfam Score | 99.09 |
| Assigned Pfam label(s) | CL0105- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S2S3Y9 | 4-131 | FSLPEPTGKYAIGTISQHLTDQSRDETLSATPGDKRELMINVWYPVDPDVAKQKPKEPYPAELGEAISLVFGIPKQLFSYLTTIPTH… |
| A0A6N4T8B0 | 19-159 | HIDQIRPDAPELAAYGQHRVGVTSLNLVNPKQVDILNSKPGGETVYYDRPLTVEIWYPATLKPQQASGGKYQTYLRDGKTEVSLSGQ… |
| A0A6N6RXG3 | 2-103 | None |
| A0A2G6IBL3 | 10-116 | None |
| A0A2N9LKD9 | 52-231 | None |
| A0A537UE84 | 75-199 | None |
| A0A3N4IS03 | 45-215 | None |
| A0A1F2V7E7 | 17-174 | None |
| A0A7T8QU33 | 2-126 | None |
| A0A291QM22 | 47-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.