DPCstruct | MC34681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 204 ± 33 aa |
| Standard deviation of domain lengths | 33.08 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 66.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R0JS01 | 143-332 | ESESHESLVSGAEWESESPKAGFSSTASGWPSFDDIKSSSLTYSLSAEEKATVAVLQLQHRALEACQKFLVGDAGSDSDEDDEEAED… |
| A0A453FJU4 | 1-144 | PAEPPAQQPVAARCPQADAVRACRALFEEHADDDDDGEEGEEEEGDVARFFDELLEKDAGLRGFYEAERETGRFLCLVCEGVGARAG… |
| A0A6A2YHY6 | 4-255 | None |
| A0A2P6P6P3 | 41-264 | None |
| A0A835EN55 | 42-284 | None |
| A0A445JJN1 | 39-230 | None |
| A0A2P5FKX6 | 3-286 | None |
| A0A833V1I5 | 203-401 | None |
| Q0WKY3 | 3-189 | None |
| A0A287VP83 | 134-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.