DPCstruct | MC34680
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 93 ± 18 aa |
| Standard deviation of domain lengths | 18.42 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 70.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 53.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13259 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R0JI82 | 37-107 | AWGLLLWNQMRRQWVGNRRRENKKQVGEPIISWNATYESLMGTNKPFHRPIPLGEMVDFLVDIWEMEGLYD |
| A0A396JZW0 | 10-86 | FEANFHFSANAWHENRKKWVGDKAMHSPRTPKDPIISWSTSYEDLLSTHEPFAERIPLPEMVDFLVDIWLDEEGTFE |
| A0A484KNW7 | 1-87 | None |
| G7JB23 | 23-132 | None |
| A0A837AVS6 | 123-191 | None |
| A0A565AQV8 | 296-402 | None |
| A0A6P4BYM1 | 47-142 | None |
| A0A1D6QR58 | 133-201 | None |
| A0A6P6FV06 | 40-158 | None |
| A0A1U8EZ78 | 33-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.