DPCstruct | MC3468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 190 ± 13 aa |
| Standard deviation of domain lengths | 12.68 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8U515 | 245-436 | RQWPGGLEFFNIWLSWQDKRIGHDQDGFNFVSRGYYFHGDADMPLATQTQDRMFYCAYSNTTAVSFLPASMFGNTYTYVNARLWEKL… |
| A0A176VEX7 | 474-647 | TAVAKAMAAVWKNQLLADDQIWDQNGFNDLMKKKLGPSVDEDSGLVYAYDGSLKLGILPVSLFCSGHTYFVQGLYKQLKLEPYAVHT… |
| A0A1Y1I391 | 706-902 | None |
| A0A7S0RA28 | 6-189 | None |
| E1ZAF1 | 79-294 | None |
| D8U5C5 | 205-385 | None |
| A0A7S0Z564 | 2-197 | None |
| A0A2P6VIT2 | 76-240 | None |
| A0A0M0J5I3 | 5-204 | None |
| A0A699ZST6 | 1-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.