DPCstruct | MC34676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 502 ± 108 aa |
| Standard deviation of domain lengths | 108.40 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 63.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R0HC19 | 46-530 | ESGNEDKKLNSGKICQVIDQLVELPMEHQIYDIIDAAGSCGITLKEICERLGIELKKSHIRLVNLCYRFGMKVQEEQCLKSKANRVW… |
| H9J3K8 | 5-534 | ANIFNIEDREVIDSKKQRVMKRKYIQIVPQSDESSDSEDENNVEPIKCQYKVGVTILRQAYELLLAAGRKGLTQVDISKMLGVEVYT… |
| A0A1U8PLQ5 | 1-403 | None |
| A0A8B6CK73 | 139-918 | None |
| A0A0E0PRF7 | 66-529 | None |
| A0A6P3Z5K5 | 4-428 | None |
| A0A1S4BZJ4 | 11-629 | None |
| A0A453P4X3 | 54-456 | None |
| A0A329SYX1 | 4-434 | None |
| A0A7N6BZB9 | 161-702 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.