DPCstruct | MC3467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 158 ± 24 aa |
| Standard deviation of domain lengths | 23.84 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 26.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838DGJ2 | 1-108 | DCRYCHSFVDVAAHSNIPNTQTCMACHQQVQKDNPKLEPIRASWKTGQPVQWVQIHRTPDYVYYNHAAHVNRGISCHSCHGQVNEMA… |
| A0A2V9G5P4 | 449-598 | SGTGSEPPEIKPPLLAPTQPIPFSHRGHVAAGMSCDNCHQLSSDGKQMQIPSVTGCMACHQSVMEARPAIQKMTQLEKEGQQISWVR… |
| A0A7Y5GB02 | 27-189 | None |
| A0A7T9DEC2 | 1-169 | None |
| A0A257TPG2 | 28-158 | None |
| A0A7X5VSU2 | 544-683 | None |
| A0A7W1EK96 | 20-167 | None |
| A0A3M1QFG4 | 21-172 | None |
| A0A6L8UEK9 | 405-601 | None |
| A0A0P1MSJ3 | 246-433 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.