DPCstruct | MC34661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 81 ± 12 aa |
| Standard deviation of domain lengths | 12.11 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.50 |
| Pfam Score | 92.42 |
| Assigned Pfam label(s) | CL0044- PF06243 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A142L7N3 | 2-85 | DNWETYEVFHQKKRGDQHMHVGIVHAPNPEMALLFGKDQYGRRGITANIWVVKTANVFCTEYEDQDMFETTPEKQYREAGGYKV |
| A0A2E8QWC6 | 2-63 | REFVYDVFTRKERGDRLQHVGYVDAFDDETAKVYAWTTYSEEKWFEMCVVKRVNVLPVNRTD |
| A0A4Q4XII4 | 3-89 | None |
| A0A3M0WXE2 | 5-84 | None |
| A0A4Q4WSS5 | 3-87 | None |
| A0A521XUK0 | 15-97 | None |
| A0A2W5YYU0 | 6-72 | None |
| K6P1U3 | 6-90 | None |
| A0A800IHS5 | 1-80 | None |
| A0A510HH65 | 2-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.