DPCstruct | MC3466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 106 ± 11 aa |
| Standard deviation of domain lengths | 10.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A031HK20 | 1-91 | MDEIVEAETRLFDRVWYHRSLQHEYRLQDANNHVEIEQLRAIAGPGRKRVEETCNLPGELGPYTDFELGMLNGKLSALRWVLGSEWD… |
| A0A2V9G5N0 | 1-119 | MSGCGIDKIELEYVIGGRRSLLHEYDLIKEKHKTRSLQQIQRAEHEFFEKIWYGRSASESEMQKWDPKLRRSVKRSQQEIEKKYGKK… |
| A0A543BD54 | 214-336 | None |
| A0A380C0U6 | 128-236 | None |
| B9NWP4 | 25-135 | None |
| A0A059DSQ5 | 106-216 | None |
| A0A370NGB3 | 57-174 | None |
| A0A7W0W8F6 | 69-168 | None |
| A0A0R3LGB2 | 233-347 | None |
| A0A353YBX2 | 56-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.