DPCstruct | MC34658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 161 ± 14 aa |
| Standard deviation of domain lengths | 13.58 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15087 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8FVV8 | 3-157 | LDAELQKLILEYTDTATALLYEILLVFQQGNLGLGSTTFAISWMMSFLQSHPPIVTFVDSIVKQVVKGLSASFQLVGPSQAVLLYQQ… |
| K1QLH5 | 2-166 | EFLTEINRTIKKQIDEFRKSALLTLFEIFLMARQANWGNREASFFNISWVIKTMEEMRMTEGFVENVIDQMMKFIGPTRKDALMPQE… |
| A0A2B4R869 | 42-221 | None |
| A0A819SG09 | 13-180 | None |
| A0A7J5ZEE1 | 507-675 | None |
| A0A4Z2EJN9 | 17-141 | None |
| A0A5N4DET7 | 22-189 | None |
| A0A7M7LPC5 | 572-735 | None |
| A0A812DA44 | 169-322 | None |
| A0A7R9GZT1 | 106-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.