DPCstruct | MC34655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 106 ± 8 aa |
| Standard deviation of domain lengths | 8.36 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00777 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8FDM7 | 1-121 | MRIINSQILTNPNHHFLDSSLYKDVILVAWDPAPYSANLNQWYKKPDYNLFTPYVQHRQRHPNQPFYILHPKFIWQLWDIIQENTKE… |
| A0A384D8L2 | 3-104 | SQLVTTEGRFLKDSLYNEGILIVWDPSVYHSDIPKWYQSPDYSFFENYKSYRKLHPDQPFYILKPQMPWELWDIIQEVSPEEIQPNP… |
| A0A836AJ73 | 314-413 | None |
| A0A498M8P2 | 126-231 | None |
| A0A670I7T2 | 446-560 | None |
| A0A6G0HH66 | 235-329 | None |
| A0A4C1U523 | 109-207 | None |
| A0A1V9XEV8 | 43-145 | None |
| A0A7R8HAY1 | 68-174 | None |
| A0A2D0T222 | 403-502 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.