DPCstruct | MC34652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 102 ± 9 aa |
| Standard deviation of domain lengths | 8.66 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 29.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A329K7Q7 | 77-182 | KGYFMVPSRIHIMEPNNNTNLSNFIERINMTNFNYFIAPAFFNPKVSNYDIKYENIIKKNKIEIKDAWEVGEDSWLSFAITIEDNPI… |
| I3CRB2 | 1-116 | MKAATDDNRVLAMVYRIHDMTPSSSRNLDVLQEHFRRAGSVFLIPVAFNPVSPDIEMTSKNFDLGIKLSHLQFIPAWKVSENSPLVS… |
| A0A3M4WUE4 | 1-90 | None |
| A0A0X3TN97 | 56-167 | None |
| A0A367R2S6 | 295-400 | None |
| A0A0Q4SFC4 | 627-732 | None |
| A0A2V9KTN9 | 354-450 | None |
| A0A1Y3CKL4 | 1-93 | None |
| A0A2N0V928 | 146-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.