DPCstruct | MC3465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 54 ± 3 aa |
| Standard deviation of domain lengths | 3.03 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 43.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9FMW5 | 38-90 | SRSAGLCGDCRHSRRVRSAHGSVFFLCQLSLTDPRFPKYPRLPVLSCDGYEKK |
| A0A2G4JDF3 | 5-58 | DPGLCGDCGFARVIDGERSTFHLCERALTDWRFRKYPALPVWSCPGYQRREPQG |
| A0A2V7SFL6 | 7-58 | None |
| A0A2V9CUB4 | 1-52 | None |
| A0A2V9CKT5 | 2-55 | None |
| A0A3N5SCQ9 | 15-73 | None |
| A0A2D9WMK5 | 6-63 | None |
| A0A1H7L4N5 | 15-70 | None |
| A0A2V9H5P7 | 8-63 | None |
| A0A7C7WY22 | 2-50 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.