DPCstruct | MC34648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 90 ± 10 aa |
| Standard deviation of domain lengths | 10.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4B0R6 | 4-82 | SRRRFHFSNGMDDLVDMKWTVIDWDTRRWLQLIGPSELLGGDDIEAYRQIAARFADQLGPDQHTIVVDKNGALEKFTRE |
| A0A420NQM4 | 1-103 | MIDKDSKYFSLSGDIPIGGPSTWHSIDWDQRRVVSVTMDGEQDDESLAIEHFSRHSDQLSPDIHRIYVSHNGEINSTYTDSKNDPTC… |
| A0A0A2K640 | 1-99 | None |
| A0A3S4C7S7 | 2-92 | None |
| M7TX90 | 1-85 | None |
| A0A1V6TCI1 | 1-104 | None |
| A0A0F8UZF1 | 39-140 | None |
| A0A0L1JIW2 | 35-118 | None |
| A0A423W878 | 5-84 | None |
| A0A5Q3DSY9 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.