DPCstruct | MC34642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 130 ± 14 aa |
| Standard deviation of domain lengths | 14.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.54 |
| Pfam Score | 90.91 |
| Assigned Pfam label(s) | PF09055- PF04998- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G1TVU6 | 90-226 | MYSFFLPQSVHAHCDIPCGIYTTCQTSIAAETVEKMVQKIQELRKTDKTEIDKNHELARLVAVKEEWAEICKRELFILWADYFKPEH… |
| A0A6J6MP41 | 2-93 | EKYAASSDPDFKSRAVAVKEVRSHQVKEHLWVLWTDYFKPNHFEAYPNLHTLFNEATKLAGATGTKGTNDVAVADKLLAKIEEISEI… |
| A0A1E4ZK87 | 10-151 | None |
| A0A3M1DBB1 | 1-124 | None |
| A0A813BUI9 | 1053-1184 | None |
| A0A6I5X4Z6 | 145-267 | None |
| A0A3L7W0U1 | 39-177 | None |
| A0A5N9AQJ8 | 13-134 | None |
| A0A7Y3LMA9 | 2-114 | None |
| X5CVB3 | 4-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.