DPCstruct | MC3464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 213 ± 22 aa |
| Standard deviation of domain lengths | 22.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T0JML1 | 43-252 | VAYQEDLRRQSTLQRVRESLPESWPPNAAIALLPRNQQSLIPLSRKRIQAHRRHLEQVVRQAREQREADESIATETRATTSGVSPGQ… |
| A0A3D5PPH0 | 299-484 | VGHTPFLLKQLQKPDPEKTRALFDHLMQLELDSVSAEEAQPTGHEGTPPVEFEALCRGCQGNCCTLALGRKAFIDAKTAKRAALYIN… |
| A0A0K8P7G5 | 57-303 | None |
| A0A4Y9S5R6 | 52-281 | None |
| A0A5C5Z4M2 | 132-360 | None |
| A0A519YX61 | 86-298 | None |
| A0A7Y3EF03 | 12-202 | None |
| A0A518L1F7 | 9-230 | None |
| A0A2D9VJQ0 | 86-305 | None |
| B6B3E2 | 1-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.