DPCstruct | MC34638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 152 ± 10 aa |
| Standard deviation of domain lengths | 10.06 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M3VCI2 | 6-158 | PVVGDRVVVRYRLARDAPADWRNAPNPALPHSPTLSDVTGVLVAADADRFVVRRDDVEHTIPRTAITAVRTLSRRVVRNSEIRDVER… |
| A0A1J5VMI1 | 1-163 | MSVRYRTESGVNEALGQVVGLDPLRVRRRDGREVTITEPVVLRSLAPRTVRNSEIRRKEVELAEANSAPVQEWVEGWLARAGAAAPL… |
| A0A7U8UHH8 | 1-165 | None |
| A0A4D4LP33 | 18-156 | None |
| A0A2W6C1J7 | 10-147 | None |
| A0A7K3LVU2 | 17-175 | None |
| A0A1X1XE97 | 1-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.