DPCstruct | MC34636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 108 |
|---|---|
| Mean domain length (aa) | 194 ± 39 aa |
| Standard deviation of domain lengths | 38.84 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 74.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.90 |
| Pfam Score | 71.23 |
| Assigned Pfam label(s) | CL0229- PF15815- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D6XXK2 | 461-648 | LFYYGAPGEFAASDMAAPPQHSGPSKTCTYFLQGLCRYGDSCFYLHALREDVDTEDDMLEIGRELQASAELECNICYDNILQKEERF… |
| A0A287UL68 | 22-176 | ICSFAAAGTCPYGEECPQTHGDLCTTCGKQCLHPYRPSEGGAHIKLCKRNNKRLEALKKSEEIECSVCLDRVLSKPTAAEKRFGLLP… |
| H0Z0R7 | 508-785 | None |
| A0A814Q290 | 13-144 | None |
| A0A3Q1GFF6 | 150-337 | None |
| A0A383WCS5 | 10-193 | None |
| A0A2G5UCV8 | 155-371 | None |
| A0A7S2XVW4 | 1-218 | None |
| G3WTM3 | 59-267 | None |
| B8C7B5 | 7-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.