DPCstruct | MC34630
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 198 ± 19 aa |
| Standard deviation of domain lengths | 18.79 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372JHP7 | 181-362 | GVDPLPARLVKSSARMATVLRRGIEQQGGTRALTRHLKDGAFAFVFEGAFLSVPQADLEKFLAWESGAYNAQRLAFGTRLVDALTAA… |
| D6AAH0 | 114-306 | GTDTPRARLVKSDERMAAVLRRRVERECRPEALDALLTAPSFEGDEPAFTVTAGSTTLRVPRSQVLTLFEQAHGGDGAHRERRDRFR… |
| A0A511N8K0 | 304-502 | None |
| A0A839DU55 | 116-338 | None |
| A0A7W8BL55 | 319-511 | None |
| A0A2S8WTC5 | 253-436 | None |
| A0A0K2RDT5 | 14-218 | None |
| A0A840VYP4 | 280-494 | None |
| A0A2G7D6A9 | 267-487 | None |
| A0A7J0D6M9 | 273-432 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.