DPCstruct | MC34629
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 140 ± 17 aa |
| Standard deviation of domain lengths | 17.20 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8A9ER36 | 565-693 | LMQVEMFTEYRKAFDNLTSTVQRKKQKSYKDMGEHDQAIEMRKKLMAYIQGIEKEKLYYFVLATINPNKVVIVKSPSDTKEAKNFLG… |
| A0A5L4JYM2 | 1-141 | MYLDLQEYSILYTNESFQEYVNAYKALIQKEKDEYNKKSDKHKAQNPFTPSQSKQEFIRKLEAEKFLYFCYSLDSSPLIIKAPSDNK… |
| R7R1R8 | 298-452 | None |
| R9IRS5 | 450-570 | None |
| A0A1T0A4T8 | 1-125 | None |
| A0A6L5XBG8 | 710-882 | None |
| A0A2X3B5H9 | 2-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.