DPCstruct | MC34628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 206 ± 20 aa |
| Standard deviation of domain lengths | 19.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 94.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381EKM6 | 2-172 | IENIKASKLRAEFDTSFMDRAIYPDGGILFLKKKDEPNFAKVLLITEAKRQGTNDERAKEGRKKQATGNAIERLGKNLTGIKAMLNH… |
| I9VXG8 | 42-221 | VMQKLEDEFKSLSFRHRASITKEEINSVLQGLDDELGRTLFIQSSKIKPDGGIIEVKDDDGNWRVILITEAKYQGKDIENIQKGILV… |
| I4IRE3 | 42-268 | None |
| A0A1V5SWN0 | 40-266 | None |
| A0A6C0LIN2 | 62-284 | None |
| A0A1H9J2Y9 | 31-240 | None |
| A0A2T6S0K0 | 13-210 | None |
| A0A7X3NWU6 | 15-194 | None |
| M3LFR6 | 2-213 | None |
| A0A6C0B6E5 | 127-347 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.