DPCstruct | MC34621
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 199 ± 20 aa |
| Standard deviation of domain lengths | 20.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03744 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q8KZN1 | 8-209 | YSVRMRASMNGSHEDGGKHISGGERLIPFHEMKHTVNALLEKGLSHSRGKPDFMQIQFEEVHESIKTIQPLPVYTNEVSCPGEGQKL… |
| A0A5C2NTB2 | 2-215 | TFYSVRMRASLQGQHISGAETLVSCPTDVPRLTAQFVERAMNHAKGVPDAITTKIESIPESDIQRVPRLLTREYQARDCHDAHGFVQ… |
| A0A7V0R5J8 | 11-166 | None |
| A0A822IWV7 | 4-181 | None |
| A0A7U0CR33 | 2-193 | None |
| A0A349EP60 | 31-243 | None |
| T2RGI3 | 2-187 | None |
| A0A1J5NYP4 | 1-230 | None |
| A0A239W4J2 | 2-208 | None |
| F5LAY0 | 2-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.