DPCstruct | MC3462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 130 ± 6 aa |
| Standard deviation of domain lengths | 6.33 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E4HAR0 | 101-224 | KAREVEPDLEKHHFALPVLEALLNEDKGEEFTNMDTRLFDNQNVRKKFEAIGENDLYDLYYEYDTNFTHGLWGAIRESAMIFCDNPS… |
| U5NA05 | 1-124 | MEPPKFINIEWIEQIAGEDIWEEFLNIELGNWSGLDLRKLSEQSGCKDQYDTHYSWTSGYVHGTWGPVREASFTTCGNPLHRMHRYP… |
| A0A2B7GQH2 | 348-472 | None |
| A0A0C1FRH4 | 6-135 | None |
| A0A7C2WLW3 | 1-142 | None |
| A0A538NX10 | 251-374 | None |
| A0A6P1MHV7 | 299-429 | None |
| A0A2T2Q4I5 | 136-260 | None |
| A0A1S1U9W5 | 23-153 | None |
| A0A7Y2W5I3 | 387-527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.