DPCstruct | MC34617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 75 ± 10 aa |
| Standard deviation of domain lengths | 9.92 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0619 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S9VC81 | 1-78 | MEFKTIDLYGGAMRCAVPCVVEDMSAFRQVPDHQEVWSDPATGCTVIVELLARQERVSDGAASDFFYRDLAKDNGCSA |
| A0A3M7F0R4 | 2-86 | TTYTPTPLFGGALSASLPSTFGDVSDIRQVPDHQEVWLDRDGYTSVVFEILERVEKGGSDEEALKYHLEDLVEEEDMGRMKVWGS |
| A0A183NFK1 | 1-62 | None |
| A0A4S4DC78 | 5-73 | None |
| A0A317WUD2 | 1-91 | None |
| A0A1E5R7C6 | 5-92 | None |
| A0A1Q9C2K6 | 256-317 | None |
| I1CTI5 | 1-66 | None |
| A0A177WHW7 | 6-76 | None |
| A0A4W6CXV0 | 36-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.