DPCstruct | MC34614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 187 ± 2 aa |
| Standard deviation of domain lengths | 2.06 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 93.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 44.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09338 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2X7H2 | 1-189 | LKVNSIMDIIPISTKVSGKIGTGVSHTLTGVEVMLTGASASGIQIHDFGSSDGYLDEKMVFGRNGTPDENDIIIGLDVITAEDYSLD… |
| A0A7Y8VSH8 | 230-416 | IHINSNLDFMPIACKEEGVIGMGVTRQLEGVSVMLNGVEYGSGFQPANIGSSEGILDERVCFDQAGTSRSTDIILHFDFLFEEGEGR… |
| T2RDJ3 | 1-183 | None |
| A0A0P8WM07 | 208-393 | None |
| A0A7C6VC40 | 69-256 | None |
| A0A162MLH3 | 106-294 | None |
| A0A4R2JAT4 | 67-252 | None |
| T4VVY3 | 13-199 | None |
| A0A7Y8VS03 | 127-314 | None |
| B2A2P8 | 62-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.